KEGG   Rattus norvegicus (rat): 363875
Entry
363875            CDS       T01003                                 
Symbol
Rac1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04145  Phagosome
rno04148  Efferocytosis
rno04151  PI3K-Akt signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04972  Pancreatic secretion
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    363875 (Rac1)
   04014 Ras signaling pathway
    363875 (Rac1)
   04015 Rap1 signaling pathway
    363875 (Rac1)
   04310 Wnt signaling pathway
    363875 (Rac1)
   04370 VEGF signaling pathway
    363875 (Rac1)
   04071 Sphingolipid signaling pathway
    363875 (Rac1)
   04024 cAMP signaling pathway
    363875 (Rac1)
   04151 PI3K-Akt signaling pathway
    363875 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    363875 (Rac1)
   04148 Efferocytosis
    363875 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    363875 (Rac1)
   04520 Adherens junction
    363875 (Rac1)
   04530 Tight junction
    363875 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    363875 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    363875 (Rac1)
   04620 Toll-like receptor signaling pathway
    363875 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    363875 (Rac1)
   04662 B cell receptor signaling pathway
    363875 (Rac1)
   04664 Fc epsilon RI signaling pathway
    363875 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    363875 (Rac1)
   04670 Leukocyte transendothelial migration
    363875 (Rac1)
   04062 Chemokine signaling pathway
    363875 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    363875 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    363875 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    363875 (Rac1)
   04380 Osteoclast differentiation
    363875 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363875 (Rac1)
   05205 Proteoglycans in cancer
    363875 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    363875 (Rac1)
   05203 Viral carcinogenesis
    363875 (Rac1)
   05231 Choline metabolism in cancer
    363875 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    363875 (Rac1)
   05212 Pancreatic cancer
    363875 (Rac1)
   05211 Renal cell carcinoma
    363875 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    363875 (Rac1)
   05163 Human cytomegalovirus infection
    363875 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    363875 (Rac1)
   05169 Epstein-Barr virus infection
    363875 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    363875 (Rac1)
   05135 Yersinia infection
    363875 (Rac1)
   05100 Bacterial invasion of epithelial cells
    363875 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    363875 (Rac1)
   05020 Prion disease
    363875 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    363875 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    363875 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    363875 (Rac1)
   05415 Diabetic cardiomyopathy
    363875 (Rac1)
   05416 Viral myocarditis
    363875 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    363875 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    363875 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363875 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    363875 (Rac1)
   04031 GTP-binding proteins [BR:rno04031]
    363875 (Rac1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    363875 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    363875 (Rac1)
  Macropinocytosis
   Ras GTPases
    363875 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    363875 (Rac1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   363875 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   363875 (Rac1)
  Exosomal proteins of colorectal cancer cells
   363875 (Rac1)
  Exosomal proteins of bladder cancer cells
   363875 (Rac1)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    363875 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 363875
NCBI-ProteinID: NP_599193
RGD: 619755
Ensembl: ENSRNOG00000001068
Vega: OTTRNOG00000001911
UniProt: Q6RUV5 A6K1K8
Position
12:16150411..16170864
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagccgttggtaaaacctgcctgctc
atcagttacacgaccaatgcgttccctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcctctgggacacagctgga
caggaagattatgacagactgcgtcccctctcctacccgcaaacagacgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtacgacaccactgtcccaatactcccatcatcctagtggggacgaagcttgatcttagg
gatgataaggacacgattgagaagctgaaggagaagaagctgactcccattacctacccg
caggggctagccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagcactc
acacagcgaggactcaagacagtgtttgatgaagctatccgagccgttctctgtccccct
cctgttaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system